PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00103.1.g00400.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NF-YA
Protein Properties Length: 227aa    MW: 24730 Da    PI: 10.5396
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00103.1.g00400.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.12.6e-3271127158
                       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                     +ep++VNaKQy++Il+RRq+Rakle+++kl  k r+pylheSRh+hA++R RgsgGrF
  Zjn_sc00103.1.g00400.1.sm.mkhc  71 EEPIFVNAKQYHAILRRRQARAKLEAQNKL-VKVRRPYLHESRHRHAMKRVRGSGGRF 127
                                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-3669130IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.02470130IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.6E-2772127IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.3E-257395IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607595IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.3E-25104127IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSSAYLAAGE ETSSVSAVII FSGERERETI QGRTERIELS LGGCAAFGSV HPQINGTANS  60
RLPLPIEPAA EEPIFVNAKQ YHAILRRRQA RAKLEAQNKL VKVRRPYLHE SRHRHAMKRV  120
RGSGGRFLNK KELQEQQQKA VPSLKTPTGG VSKMGDVGNR CTESSTPWLP STPTSTGISS  180
VSNGGGMLAH QEHINFSTFD PSMGFNAQNG GEKMAANGVC YRTPIMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2571147272NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111120RHRHAMKRVR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984044.18e-77PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_004984045.18e-77PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_004984046.16e-77PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X2
TrEMBLA0A0A9LTJ83e-82A0A0A9LTJ8_ARUDO; Uncharacterized protein
STRINGSi036728m2e-76(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.17e-32nuclear factor Y, subunit A6